2026-08-01 crawl · observed, not inferred

Technology used by actividadesdeinfantilyprimaria.com

Recursos para trabajar en infantil y primaria

36
technologies detected

Recent changes

2026-08-01 dropped Facebook Loginprovisional
2026-05-01 dropped Media.netconfirmed
2026-05-01 dropped Elastic APMconfirmed
2026-05-01 dropped Sharethroughconfirmed
2026-05-01 dropped Elasticsearchconfirmed
2026-05-01 dropped Sovrnconfirmed
2026-05-01 dropped Adformconfirmed
2026-03-01 dropped Cart Functionalityconfirmed
2026-02-01 dropped Microsoft ASP.NETconfirmed
2026-01-01 dropped Cart Functionalityprovisional

Full detected stack

Everything detected on this domain in the latest monthly crawl, grouped by what it does. marks when we first observed it — no later than that date, not necessarily when they adopted it. Faded dates were seen in fewer than four crawls.

Advertising
Rubicon ProjectApr 2023PubMaticJul 2023OpenXJul 2021AppNexusMay 2018Prebid9.12.0May 2024ID51.0.97Sept 2025Google Publisher TagJun 2023Google AdSenseJul 2017DoubleClick for Publishers (DFP)May 2024
JavaScript libraries
Lodash4.17.21May 2024PreactNov 2022jQuery Migrate3.4.1May 2018jQuery3.7.1May 2018
WordPress plugins
Yoast SEO28.2|28.2Feb 2025Site Kit1.185.0|1.185.0Jul 2022
Analytics
Snowplow AnalyticsApr 2025Google AnalyticsMay 2018
Font scripts
Twitter Emoji (Twemoji)May 2018Google Font APIJul 2017
Miscellaneous
RSSDec 2022Open GraphSept 2022
Page builders
WordPress Block EditorJul 2024
Ecommerce
Cart FunctionalityAug 2020
CMS
WordPressJul 2017
Databases
MySQLMay 2018
Programming languages
PHPMay 2018
Operating systems
UbuntuApr 2023
WordPress themes
Genesis themeDec 2024
UI frameworks
BootstrapJun 2026
Caching
WordPress Super CacheMar 2024
Web servers
Nginx1.18.0|1.18.0Jul 2017
CDN
CloudflareApr 2024
Tag managers
Google Tag ManagerFeb 2021
Performance
Priority HintsAug 2026
Security
Cloudflare Bot ManagementApr 2024
Segmentation
Adobe Audience ManagerDec 2022
Who else runs this stack?

Build a list of companies using any of these, filtered by size, industry and country — with every prospect's full stack attached.

Build a list →