2026-08-01 crawl · observed, not inferred
Technology used by srisubrahmanyaswamydevalayamskandagiri.org
9
technologies detected
Full detected stack
Everything detected on this domain in the latest monthly crawl, grouped by what it does. ↩ marks when we first observed it — no later than that date, not necessarily when they adopted it. Faded dates were seen in fewer than four crawls.
JavaScript libraries
Programming languages
Video players
Web servers
Webmail
Who else runs this stack?
Build a list of companies using any of these, filtered by size, industry and country — with every prospect's full stack attached.
Build a list →